- Recombinant Human cytomegalovirus Membrane glycoprotein UL9 (UL9)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1163860
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 26,998 Da
- E Coli or Yeast
- 21-233
- Membrane glycoprotein UL9 (UL9)
Sequence
QYWNYMTIPCTPTVGYGSHNISLHPLNNSLFQDDVFEWYIDKPMVTNKLCLYQSNERIKSNLDSPNIMWQCTDNRTLILMNLTTTYSRNYYFQSFKYLGQGVPKPNNLCYNVSVHFTHQTHCHTTTSSLYPPTSVHDSLEISQSFTSTNFTHTAVHYAAGNVEAQHDTATSHTMWIIPLVIVITIIVLICFKFPQKAWNKFTQYRYSGMLAAA